Bay 55-9837

Catalog No.: A22923

VPAC2 agonist

Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes.
Grouped product items
Product Name Price Stock Qty
Bay 55-9837 1mg
$320.00
In stock
Bay 55-9837 5mg
$824.00
In stock
Bay 55-9837 10mg
$1,330.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes.
Product Information
Catalog Num A22923
Formula C148H239ClN44O42
Molecular Weight 3740.04
CAS Number 463930-25-8
Sequence His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2
Sequence shortening HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Bay 55-9837 | Bay 55-9837 Supplier | purchase Bay 55-9837 | Bay 55-9837 cost | Bay 55-9837 manufacturer | order Bay 55-9837 | Bay 55-9837 distributor | buy 463930-25-8 | 463930-25-8 Supplier | purchase 463930-25-8 | 463930-25-8 cost | 463930-25-8 manufacturer | order 463930-25-8 | 463930-25-8 distributor