Bay 55-9837

Name: Bay 55-9837
Brand: Adooq Bioscience
SKU: A22923
Rating: 5 (288 reviews)

Catalog No.: A22923

VPAC2 agonist

Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes.

Skip to the end of the images gallery

Bay 55-9837 463930-25-8 <p>VPAC2 agonist</p>

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
1mg	$315.00	In stock
5mg	$815.00	In stock
10mg	$1,325.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	Bay 55-9837 is a potent and highly selective agonist of VPAC2, with a Kd of 0.65 nM. Bay 55-9837 may be a useful therapy for the research of type 2 diabetes.

Product Information

Catalog Num	A22923
Formula	C148H239ClN44O42
Molecular Weight	3740.04
CAS Number	463930-25-8
Sequence	His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2
Sequence shortening	HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂