Beinaglutide

Catalog No.: A22777

Beinaglutide is a human GLP-1 polypeptide that shares almost 100% homology with human GLP-1 (7-36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH).

Grouped product items
Product Name Price Stock Qty
Beinaglutide 1mg
$124.00
In stock
Beinaglutide 5mg
$260.00
In stock
Beinaglutide 10mg
$460.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription

Beinaglutide is a human GLP-1 polypeptide that shares almost 100% homology with human GLP-1 (7-36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH).

Product Information
Catalog Num A22777
Formula C149H225N39O46
Molecular Weight 3298.61
CAS Number 123475-27-4
Sequence shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Synonyms GLP-1 (human
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Beinaglutide | Beinaglutide Supplier | purchase Beinaglutide | Beinaglutide cost | Beinaglutide manufacturer | order Beinaglutide | Beinaglutide distributor | buy 123475-27-4 | 123475-27-4 Supplier | purchase 123475-27-4 | 123475-27-4 cost | 123475-27-4 manufacturer | order 123475-27-4 | 123475-27-4 distributor