Beinaglutide is a human GLP-1 polypeptide that shares almost 100% homology with human GLP-1 (7-36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH).
Loading distributor info...
| Description | Beinaglutide is a human GLP-1 polypeptide that shares almost 100% homology with human GLP-1 (7-36). Beinaglutide displays does-dependent effects in glycemic control, inhibiting food intake and gastric empty and promoting weight loss. Beinaglutide has the potential for the research of overweight/obesity and nonalcoholic steatohepatitis (NASH). |
|---|
| Catalog Num | A22777 |
|---|---|
| Formula | C149H225N39O46 |
| Molecular Weight | 3298.61 |
| CAS Number | 123475-27-4 |
| Sequence shortening | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR |
| Synonyms | GLP-1 (human |
| Storage | Store lyophilized at -20ºC, keep desiccated. |
This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:
Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)
Please check COA/MSDS for correct molecular weight.
Calculate the dilution required to prepare a stock solution.This equation is commonly abbreviated as: C1V1 = C2V2
