BeKm-1

Catalog No.: A23126
BeKm-1 is a HERG (human ether-a-go-go-related gene) blocking compound. BeKm-1 can be used for the research of heart disease.
Grouped product items
Product Name Price Stock Qty
BeKm-1 0.1mg
$292.00
In stock
BeKm-1 0.5mg
$718.00
In stock
BeKm-1 1mg
$1,217.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription BeKm-1 is a HERG (human ether-a-go-go-related gene) blocking compound. BeKm-1 can be used for the research of heart disease.
Product Information
Catalog Num A23126
Formula C174H261N51O52S6
Molecular Weight 4091.65
CAS Number 524962-01-4
Sequence shortening RPTDIKCSESYQCFPVCKSRFGKTNGRCVNGFCDCF (Disulfide bridge:Cys13-Cys33;Cys17-Cys35;Cys7-Cys28)
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy BeKm-1 | BeKm-1 Supplier | purchase BeKm-1 | BeKm-1 cost | BeKm-1 manufacturer | order BeKm-1 | BeKm-1 distributor | buy 524962-01-4 | 524962-01-4 Supplier | purchase 524962-01-4 | 524962-01-4 cost | 524962-01-4 manufacturer | order 524962-01-4 | 524962-01-4 distributor