β-Endorphin, human

Catalog No.: A22783
β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.
Grouped product items
Product Name Price Stock Qty
β-Endorphin, human 1mg
$127.00
In stock
β-Endorphin, human 5mg
$351.00
In stock
β-Endorphin, human 10mg
$538.00
In stock
β-Endorphin, human 25mg
$1,194.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription β-Endorphin, human, a prominent endogenous peptide, existing in the hypophysis cerebri and hypothalamus, is an agonist of opioid receptor, with preferred affinity for μ-opioid receptor and δ-opioid receptor; β-Endorphin, human exhibits antinociception activity.
Product Information
Catalog Num A22783
Formula C158H251N39O46S
Molecular Weight 3464.98
CAS Number 61214-51-5
Sequence Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu
Sequence shortening YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy β-Endorphin, human | β-Endorphin, human Supplier | purchase β-Endorphin, human | β-Endorphin, human cost | β-Endorphin, human manufacturer | order β-Endorphin, human | β-Endorphin, human distributor | buy 61214-51-5 | 61214-51-5 Supplier | purchase 61214-51-5 | 61214-51-5 cost | 61214-51-5 manufacturer | order 61214-51-5 | 61214-51-5 distributor