Bulevirtide

Catalog No.: A22756
Bulevirtide (Myrcludex B) is a NTCP inhibitor, a linear lipopeptide of 47 amino acids. Bulevirtide inhibits HBV and HDV entry into liver cells, blocks HBV infection in hepatocytes, and participates in HBV transcriptional suppression. Bulevirtide can be used in HDV infection and compensated cirrhosis research.
Grouped product items
Product Name Price Stock Qty
Bulevirtide 1mg
$79.00
In stock
Bulevirtide 5mg
$242.00
In stock
Bulevirtide 10mg
$415.00
In stock
Bulevirtide 25mg
$738.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Bulevirtide (Myrcludex B) is a NTCP inhibitor, a linear lipopeptide of 47 amino acids. Bulevirtide inhibits HBV and HDV entry into liver cells, blocks HBV infection in hepatocytes, and participates in HBV transcriptional suppression. Bulevirtide can be used in HDV infection and compensated cirrhosis research.
Product Information
Catalog Num A22756
Formula C234H329N65O71
Molecular Weight 5398.86
CAS Number 2012558-47-1
Sequence {Myr}-Gly-Thr-Asn-Leu-Ser-Val-Pro-Asn-Pro-Leu-Gly-Phe-Phe-Pro-Asp-His-Gln-Leu-Asp-Pro-Ala-Phe-Gly-Ala-Asn-Ser-Asn-Asn-Pro-Asp-Trp-Asp-Phe-Asn-Pro-Asn-Lys-Asp-His-Trp-Pro-Glu-Ala-Asn-Lys-Val-Gly-NH2
Sequence shortening {Myr}-GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANKVG-NH2
Synonyms Myrcludex B
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Bulevirtide | Bulevirtide Supplier | purchase Bulevirtide | Bulevirtide cost | Bulevirtide manufacturer | order Bulevirtide | Bulevirtide distributor | buy 2012558-47-1 | 2012558-47-1 Supplier | purchase 2012558-47-1 | 2012558-47-1 cost | 2012558-47-1 manufacturer | order 2012558-47-1 | 2012558-47-1 distributor