CART(55-102)(rat)

Catalog No.: A23122
CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior.
Grouped product items
Size Price Stock Qty
100µg
$65.00
In stock
500µg
$195.00
In stock
1mg
$315.00
In stock
5mg
$945.00
In stock
10mg
$1,515.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Biological Activity
Discription CART(55-102)(rat) is a rat satiety factor with potent appetite-suppressing activity. CART(55-102)(rat) is closely associated with leptin and neuropeptide Y. CART(55-102)(rat) can induces anxiety and stress-related behavior.
Product Information
Catalog Num A23122
Formula C226H367N65O65S7
Molecular Weight 5259.18
CAS Number 209615-79-2
Sequence Ile-Pro-Ile-Tyr-Glu-Lys-Lys-Tyr-Gly-Gln-Val-Pro-Met-Cys-Asp-Ala-Gly-Glu-Gln-Cys-Ala-Val-Arg-Lys-Gly-Ala-Arg-Ile-Gly-Lys-Leu-Cys-Asp-Cys-Pro-Arg-Gly-Thr-Ser-Cys-Asn-Ser-Phe-Leu-Leu-Lys-Cys-Leu (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47)
Sequence shortening IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL (Disulfide bridge:Cys14-Cys32;Cys20-Cys40;Cys34-Cys47)
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy CART(55-102)(rat) | CART(55-102)(rat) Supplier | purchase CART(55-102)(rat) | CART(55-102)(rat) cost | CART(55-102)(rat) manufacturer | order CART(55-102)(rat) | CART(55-102)(rat) distributor | buy 209615-79-2 | 209615-79-2 Supplier | purchase 209615-79-2 | 209615-79-2 cost | 209615-79-2 manufacturer | order 209615-79-2 | 209615-79-2 distributor