CTCE-0214

Catalog No.: A23490
CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research.
Grouped product items
Product Name Price Stock Qty
CTCE-0214 1mg
$114.00
In stock
CTCE-0214 5mg
$281.00
In stock
CTCE-0214 10mg
$384.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research.
Product Information
Catalog Num A23490
Formula C170H254N44O40
Molecular Weight 3554.11
CAS Number 577782-52-6
Sequence shortening KPVSLSYRAPFRFFGGGGLKWIQEYLEKALN-NH2 (Lactam:Lys20-Glu24)
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy CTCE-0214 | CTCE-0214 Supplier | purchase CTCE-0214 | CTCE-0214 cost | CTCE-0214 manufacturer | order CTCE-0214 | CTCE-0214 distributor | buy 577782-52-6 | 577782-52-6 Supplier | purchase 577782-52-6 | 577782-52-6 cost | 577782-52-6 manufacturer | order 577782-52-6 | 577782-52-6 distributor