CTCE-0214

Name: CTCE-0214
Brand: Adooq Bioscience
SKU: A23490
Rating: 5 (288 reviews)

Catalog No.: A23490

CXCR4 agonist

CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research.

Skip to the end of the images gallery

CTCE-0214 577782-52-6 <p>CXCR4 agonist</p>

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
1mg	$105.00	In stock
5mg	$275.00	In stock
10mg	$375.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	CTCE-0214 is a chemokine CXC receptor 4 (CXCR4) agonist, SDF-1α (stromal cell-derived factor-1α) peptide analog. CTCE-0214 shows anti-inflammatory activity, and can be used in inflammation sepsis and systemic inflammatory syndromes research.

Product Information

Catalog Num	A23490
Formula	C170H254N44O40
Molecular Weight	3554.11
CAS Number	577782-52-6
Sequence shortening	KPVSLSYRAPFRFFGGGGLKWIQEYLEKALN-NH2 (Lactam:Lys20-Glu24)
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂