FSH Human Recombinant

Catalog No.: AP3246
Follicle Stimulating Hormone Human Recombinant
FSH Human Recombinant produced in HEK-293 cells is heterodimeric, glycosylated, polypeptide chain transfected with two expression plasmids encoding the human FSH-alpha chain (Accession # P01215) (Ala25-Ser116) and human FSH-beta chain (Asn19-Glu129) (Accession # P01225) having a total Mw of 38kDa. FSH human recombinant is purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
FSH Human Recombinant 2µg
$110.00
In stock
FSH Human Recombinant 10µg
$290.00
In stock
FSH Human Recombinant 1mg
$11,440.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP3246
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The recombinant FSH was lyophilized from a concentrated (1mg/ml) solution containing PBS.
Amino acid sequence FSH subunit alpha: APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS. FSH subunit beta: NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE.
Uniprot ACC# P01225
Purity Greater than 95% as determined by SDS-PAGE.
Stability Lyophilized recombinant FSH although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FSH should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Source HEK293
Synonyms Follitropin subunit beta, Follicle-stimulating hormone beta subunit, FSH-beta, FSH-B, Follitropin beta chain, FSH.
Transportation method Shipped at Room temp