• Sign In
  • FAQ
  • Create an Account
Currency
USD
Toggle Nav
My Cart
Search
Menu
Account
Settings
Currency
USD

GH Rainbow Trout

Catalog No.: AP3481
Growth Hormone Rainbow Trout (Oncorhynchus mykiss) Recombinant
Somatotropin Rainbow Trout (Oncorhynchus mykiss) Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21, 535 Dalton. The Rainbow Trout (Oncorhynchus mykiss) Growth-Hormone Recombinant is purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
GH Rainbow Trout 2µg
$110.00
In stock
GH Rainbow Trout 10µg
$290.00
In stock
GH Rainbow Trout 1mg
$7,920.00
In stock
Bulk Inquiry
Notify me when the price drops

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

HeadquaterContact US

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP3481
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The protein was lyophilized from a concentrated (1mg/ml) solution with 0.5% NaHCO3. Adjusted to pH-8.
Amino acid sequence AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNSDSIVSPVDKHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLITGSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCRKSLEANCTL.
Uniprot ACC# P09538
Purity Greater than 95.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.
Stability Lyophilized Growth-Hormone Rainbow Trout (Oncorhynchus mykiss) although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Source Escherichia Coli.
Synonyms GH1, GH, GHN, GH-N, hGH-N, Pituitary growth hormone, Growth hormone 1, Somatotropin.
Transportation method Shipped at Room temp
Growth Factors