• Sign In
  • FAQ
  • Create an Account
Currency
USD
Toggle Nav
My Cart
Search
Menu
Account
Settings
Currency
USD

GHBP Rabbit

Catalog No.: AP3500
Growth Hormone Binding Protein Rabbit Recombinant
Growth Hormone Binding Protein Rabbit Extracellular Domain Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 249 amino acids and having a molecular mass of 28 kDa. GHBP Rabbit is purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
GHBP Rabbit 5µg
$110.00
In stock
GHBP Rabbit 20µg
$290.00
In stock
GHBP Rabbit 1mg
$7,400.00
In stock
Bulk Inquiry
Notify me when the price drops

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

HeadquaterContact US

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP3500
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The Growth Hormone Binding Protein Rabbit was lyophilized from a concentrated (1mg/ml) solution with 0.0045mM NaHCO3.
Amino acid sequence AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP.
Uniprot ACC# P19941
Purity Greater than 98.0% as determined bySDS-PAGE.
Stability Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GHBP Rabbit should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Source Escherichia Coli.
Synonyms GHR, GHBP, GH receptor, Somatotropin receptor.
Transportation method Shipped at Room temp
Growth Factors