GIP (1-39)

Name: GIP (1-39)
Brand: Adooq Bioscience
SKU: A23520
Rating: 5 (288 reviews)

Catalog No.: A23520

GIP (1-39) (Gastric inhibitory peptide (1-39) (porcine)) is an insulinotropic peptide that stimulats insulin secretion from rat pancreatic islets. GIP (1-39) at 100 nM was able to significantly increase intracellular Ca2+ concentration ([Ca2+]i), and capable of enhancing exocytosis.

Skip to the end of the images gallery

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock	Qty
1mg	$845.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	GIP (1-39) (Gastric inhibitory peptide (1-39) (porcine)) is an insulinotropic peptide that stimulats insulin secretion from rat pancreatic islets. GIP (1-39) at 100 nM was able to significantly increase intracellular Ca2+ concentration ([Ca2+]i), and capable of enhancing exocytosis.

Product Information

Catalog Num	A23520
Formula	C210H316N56O61S
Molecular Weight	4633.21
CAS Number	725474-97-5
Sequence	Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn
Sequence shortening	YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
Synonyms	Gastric inhibitory peptide (1-39) (porcine)
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂