GIP (1-39)

Catalog No.: A23520
GIP (1-39) (Gastric inhibitory peptide (1-39) (porcine)) is an insulinotropic peptide that stimulats insulin secretion from rat pancreatic islets. GIP (1-39) at 100 nM was able to significantly increase intracellular Ca2+ concentration ([Ca2+]i), and capable of enhancing exocytosis.
Grouped product items
Product Name Price Stock Qty
GIP (1-39) 1mg
$852.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription GIP (1-39) (Gastric inhibitory peptide (1-39) (porcine)) is an insulinotropic peptide that stimulats insulin secretion from rat pancreatic islets. GIP (1-39) at 100 nM was able to significantly increase intracellular Ca2+ concentration ([Ca2+]i), and capable of enhancing exocytosis.
Product Information
Catalog Num A23520
Formula C210H316N56O61S
Molecular Weight 4633.21
CAS Number 725474-97-5
Sequence Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn
Sequence shortening YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
Synonyms Gastric inhibitory peptide (1-39) (porcine)
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy GIP (1-39) | GIP (1-39) Supplier | purchase GIP (1-39) | GIP (1-39) cost | GIP (1-39) manufacturer | order GIP (1-39) | GIP (1-39) distributor | buy 725474-97-5 | 725474-97-5 Supplier | purchase 725474-97-5 | 725474-97-5 cost | 725474-97-5 manufacturer | order 725474-97-5 | 725474-97-5 distributor