GIP (3-42), human

Catalog No.: A22751
GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.
Grouped product items
Product Name Price Stock Qty
GIP (3-42), human 1mg
$234.00
In stock
GIP (3-42), human 5mg
$688.00
In stock
GIP (3-42), human 10mg
$1,006.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription GIP (3-42), human acts as a glucose-dependent insulinotropic polypeptide (GIP) receptor antagonist, moderating the insulin secreting and metabolic actions of GIP in vivo.
Product Information
Catalog Num A22751
Formula C214H324N58O63S
Molecular Weight 4749.4
CAS Number 1802086-25-4
Sequence Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln
Sequence shortening EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy GIP (3-42), human | GIP (3-42), human Supplier | purchase GIP (3-42), human | GIP (3-42), human cost | GIP (3-42), human manufacturer | order GIP (3-42), human | GIP (3-42), human distributor | buy 1802086-25-4 | 1802086-25-4 Supplier | purchase 1802086-25-4 | 1802086-25-4 cost | 1802086-25-4 manufacturer | order 1802086-25-4 | 1802086-25-4 distributor