GLP-1(7-37)

Catalog No.: A22541
GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.
Grouped product items
Product Name Price Stock Qty
GLP-1(7-37) 1mg
$234.00
In stock
GLP-1(7-37) 5mg
$228.00
In stock
GLP-1(7-37) 10mg
$336.00
In stock
GLP-1(7-37) 25mg
$708.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription GLP-1(7-37) is an intestinal insulinotropic hormone that augments glucose induced insulin secretion.
Product Information
Catalog Num A22541
Formula C151H228N40O47
Molecular Weight 3355.67
CAS Number 106612-94-6
Sequence His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly
Sequence shortening HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy GLP-1(7-37) | GLP-1(7-37) Supplier | purchase GLP-1(7-37) | GLP-1(7-37) cost | GLP-1(7-37) manufacturer | order GLP-1(7-37) | GLP-1(7-37) distributor | buy 106612-94-6 | 106612-94-6 Supplier | purchase 106612-94-6 | 106612-94-6 cost | 106612-94-6 manufacturer | order 106612-94-6 | 106612-94-6 distributor