GLP-2(1-33)(human)

Catalog No.: A22781
GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.
Grouped product items
Product Name Price Stock Qty
GLP-2(1-33)(human) 0.5mg
$158.00
In stock
GLP-2(1-33)(human) 1mg
$244.00
In stock
GLP-2(1-33)(human) 5mg
$887.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription GLP-2(1-33) (human) is an enteroendocrine hormone which can bind to the GLP-2 receptor and stimulate the growth of intestinal epithelium.
Product Information
Catalog Num A22781
Formula C165H254N44O55S
Molecular Weight 3766.19
CAS Number 223460-79-5
Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp
Sequence shortening HADGSFSDEMNTILDNLAARDFINWLIQTKITD
Synonyms GLP-2 (human; Glucagon-like peptide 2 (human
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy GLP-2(1-33)(human) | GLP-2(1-33)(human) Supplier | purchase GLP-2(1-33)(human) | GLP-2(1-33)(human) cost | GLP-2(1-33)(human) manufacturer | order GLP-2(1-33)(human) | GLP-2(1-33)(human) distributor | buy 223460-79-5 | 223460-79-5 Supplier | purchase 223460-79-5 | 223460-79-5 cost | 223460-79-5 manufacturer | order 223460-79-5 | 223460-79-5 distributor