GLP-2 (1-34) (human)

Catalog No.: A23500
GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human) can be used for the research of bone remodeling processes.
Grouped product items
Product Name Price Stock Qty
GLP-2 (1-34) (human) 0.5mg
$1,182.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human) can be used for the research of bone remodeling processes.
Product Information
Catalog Num A23500
Formula C171H266N48O56S
Molecular Weight 3922.29
CAS Number 99120-49-7
Sequence His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg
Sequence shortening HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy GLP-2 (1-34) (human) | GLP-2 (1-34) (human) Supplier | purchase GLP-2 (1-34) (human) | GLP-2 (1-34) (human) cost | GLP-2 (1-34) (human) manufacturer | order GLP-2 (1-34) (human) | GLP-2 (1-34) (human) distributor | buy 99120-49-7 | 99120-49-7 Supplier | purchase 99120-49-7 | 99120-49-7 cost | 99120-49-7 manufacturer | order 99120-49-7 | 99120-49-7 distributor