GLP-2 (1-34) (human)

Name: GLP-2 (1-34) (human)
Brand: Adooq Bioscience
SKU: A23500
Rating: 5 (288 reviews)

Catalog No.: A23500

GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human) can be used for the research of bone remodeling processes.

Skip to the end of the images gallery

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock	Qty
500µg	$1,175.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS Compound Handling Instructions

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	GLP-2 (1-34) (human) is a polypeptide released from the intestine within minutes after food intake. GLP-2 (1-34) (human) can be used for the research of bone remodeling processes.

Product Information

Catalog Num	A23500
Formula	C171H266N48O56S
Molecular Weight	3922.29
CAS Number	99120-49-7
Sequence	His-Ala-Asp-Gly-Ser-Phe-Ser-Asp-Glu-Met-Asn-Thr-Ile-Leu-Asp-Asn-Leu-Ala-Ala-Arg-Asp-Phe-Ile-Asn-Trp-Leu-Ile-Gln-Thr-Lys-Ile-Thr-Asp-Arg
Sequence shortening	HADGSFSDEMNTILDNLAARDFINWLIQTKITDR
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂