Signaling Pathway
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
Not your Region? View all Distributors
| Catalog Num | AP5671 |
|---|---|
| Physical appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | The CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl. |
| Amino acid sequence | TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN. |
| Uniprot ACC# | Q16627 |
| Purity | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Stability | Lyophilized HCC1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL14 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Source | Escherichia Coli. |
| Synonyms | Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, SY14, HCC-1, HCC-3, SCYL2, SCYA14. |
| Transportation method | Shipped at Room temp |
