HCV NS4 a+b

Catalog No.: AP6120
Hepatitis C Virus NS4 a+b Recombinant
The E.coli derived 19 kDa recombinant protein contains the HCV NS4 immunodominant regions, amino acids 1658-1863. The protein is fused with b-galactosidase (114 kDa) at N-terminus, pI 5.45.
Grouped product items
Product Name Price Stock Qty
HCV NS4 a+b 100µg
$330.00
In stock
HCV NS4 a+b 500µg
$1,320.00
In stock
HCV NS4 a+b 1000µg
$2,640.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP6120
Formulation 20mM Tris-HCl pH 8, 8M urea.
Amino acid sequence 1658 TWVLVGGVLAALAAYCLSTGCVVIVGRVVLSGKPAIIPDREVLYREFDEMEECSQHLPYIEQGMMLAEQFKQKALGLLQTASRQAEVIAPAVQTNWQKLETFWAKHMWNFISGIQYLAGLSTLPGNPAIASLMAFTAAVTSPLTTSQTLLFNILGGWVAAQLAAPGAATAFVGAGLAGAAIGSVGLGKVLIDILAGYGAGVAGAL 1863.
Purity HCV NS4 a+b protein is >95% pure as determined by 10% PAGE (coomassie staining).
Stability HCV NS4 a+b although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Transportation method Shipped with Ice Packs