HGF B Human

Catalog No.: AP3516
Hepatocyte Growth Factor B Chain Human Recombinant
HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment (495-728) having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The HGF-B is purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
HGF B Human 2µg
$110.00
In stock
HGF B Human 10µg
$290.00
In stock
HGF B Human 1mg
$10,560.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP3516
Physical appearance Sterile Filtered clear solution.
Formulation HGF-B protein is supplied in 25mM Na. Acetate, pH 4.8, 1mM EDTA and 50% glycerol.
Amino acid sequence VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS.
Uniprot ACC# P14210
Purity Greater than 95.0% as determined by SDS-PAGE.
Stability Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Source Escherichia Coli.
Synonyms Scatter Factor, SF, Hepatopoietin, HPTA, HGF, HGFB, F-TCF, DFNB39, Hepatocyte growth factor, Hepatocyte growth factor beta chain.
Transportation method Shipped with Ice Packs