HIV-1 gp41 Long

Name: HIV-1 gp41 Long
Brand: Adooq Bioscience
SKU: AP6161
Rating: 5 (288 reviews)

Catalog No.: AP6161

The E.Coli derived protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41 395 amino acids (444-833) immunodominant regions gp41L. The protein is fused to b-galactosidase (114 kDa) at N-Terminus.

Grouped product items
Size	Price	Stock
100µg	$330.00	In stock
500µg	$1,320.00	In stock
1000µg	$2,640.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP6161
Physical appearance	Sterile filtered colorless clear solution.
Formulation	8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.
Amino acid sequence	IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL
Purity	Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.
Stability	HIV-1 gp41 Long although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Source	Escherichia Coli.
Transportation method	Shipped with Ice Packs