HIV-1 gp41 Long

Name: HIV-1 gp41 Long
SKU: AP6161
Price: 330 USD
Rating: 5 (288 reviews)

Catalog No.: AP6161

HIV-1 gp41 Long Recombinant

The E.Coli derived protein contains the full-length sequence of N-terminal epitopes of HIV-I gp41 395 amino acids (444-833) immunodominant regions gp41L. The protein is fused to b-galactosidase (114 kDa) at N-Terminus.

Grouped product items
Product Name	Price	Stock
HIV-1 gp41 Long 100µg	$330.00	In stock
HIV-1 gp41 Long 500µg	$1,320.00	In stock
HIV-1 gp41 Long 1000µg	$2,640.00	In stock

Bulk Inquiry

Notify me when the price drops

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Contact your local distributors

Not your Region? View all Distributors

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP6161
Physical appearance	Sterile filtered colorless clear solution.
Formulation	8M Urea, 20mM Tris-HCl pH 8.0, 10mM b-mercaptoethanol.
Amino acid sequence	IEFPGIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQ REKRAVGIGALFLGFLGAAGSTMGAASMTLTVQARQLLSGIVQQQNNLLR AIEAQQHLLQLTVWGIKQLQARILAVERYLKDQQLLGIWGCSGKLICTTAVPWNASWSN KSLEQIWNNMTWMEWDREINNYTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWFNITNWLWYIKLFIMIVGGLVGLRIVFAVLSVVNRVRQGYSPLSFQTHLPIPRGPDRPEGIEEEGGERDRDRSIRLVNGSLALIWDDLRSLCLFSYHRLRDLLLIVTRIVELLGRRGWEALKYWWNLLQYWSQELKNSAVSLLNATAIAVAEGTDRVIEVVQGAYRAIRHIPRRIRQGLERILL
Purity	Greater than 95.0% as determined by HPLC analysis & SDS-PAGE.
Stability	HIV-1 gp41 Long although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Source	Escherichia Coli.
Transportation method	Shipped with Ice Packs

Bioquote Limited.	The Raylor Centre,James Street, York YO10 3DW, United Kingdom Tel: 00 44 1904 431402 Fax: 00 44 1904 431409 www.bioquote.com [email protected]
Generon UK.	11 Whittle Parkway, Progress Business Park, Slough SL1 6DQ, United Kingdom Tel: +44 (0)1753 866 511 Fax: +44 (0)1753 208 899 www.generon.co.uk [email protected]