HPV 11

Catalog No.: AP6262
Human Papillomavirus 11 Recombinant
Recombinant HPV-11 antigen is a 58.1kDa protein covering the full length of HPV-11 major capsid, its N-terminus is fused with a GST tag, having a total molecular weight of 84kDa. The HPV-11 was purified by proprietary chromatographic technique.
Grouped product items
Product Name Price Stock Qty
HPV 11 100µg
$330.00
In stock
HPV 11 500µg
$1,320.00
In stock
HPV 11 1mg
$2,640.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP6262
Physical appearance Sterile filtered clear liquid formulation.
Formulation Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine.
Amino acid sequence VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR.
Purity Protein is >90% pure as determined by 10% PAGE (coomassie staining).
Stability Recombinant HPV-11 although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Source E.Coli.
Synonyms Papillomavirus, HPV, Papilloma Virus.
Transportation method Shipped with Ice Packs