HPV 18

Catalog No.: AP6260
Human Papillomavirus 18 Recombinant
The Recombinant HPV-18 is a full length large capsid protein having a Mw of 56kDa expressed in E. coli and fused to a GST-Tag, having a total Mw of 83kDa, purified by standard chromatography.
Grouped product items
Product Name Price Stock Qty
HPV 18 100µg
$330.00
In stock
HPV 18 500µg
$1,320.00
In stock
HPV 18 1mg
$2,640.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP6260
Physical appearance Sterile filtered clear liquid formulation.
Formulation Recombinant HPV-18 solution in PBS, 3M Urea and 0.02% sodium azide as preservative.
Amino acid sequence VDVYLPPPSVARVVNTDDYVTPTSIFYHAGSSRLLTVGNPYFRVPAGGGNKQDIPKVSAYQYRVFRVQLPDPNKFGLPDTSIYNPETQRLVWACAGVEIGRGQPLGVGLSGHPFYNKLDDTESSHAATSNVSEDVRDNVSVDYKQTQLCILGCAPAIGEHWAKGTACKSRPLSQGDCPPLELKNTVLEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGTMGDTVPQSLYIKGTGMPASPGSCVYSPSPSGSIVTSDSQLFNKPYWLHKAQGHNNGVCWHNQLFVTVVDTTPSTNLTICASTQSPVPGQYDATKFKQYSRHVEEYDLQFIFQLCTITLTADVMSYIHSMNSSILEDWNFGVPPPPTTSLVDTYRFVQSVAITCQKDAAPAENKDPYDKLKFWNVDLKEKFSLDLDQYPLGRKFLVQAGLRRKPTIGPRKRSAPSATTSSKPA.
Purity Protein is >90% pure as determined by 10% PAGE (Coomassie staining).
Source E.Coli
Synonyms Papillomavirus, HPV, Papilloma Virus.
Transportation method Shipped with Ice Packs