HSV-2 gB

Catalog No.: AP6139
Herpes Simplex Virus-2 gB Recombinant
The E.Coli derived HSV-2 gB recombinant protein is fused to a Six histidine tag at C-terminus and has a MW of 82kDa (pI 8.35).
Grouped product items
Product Name Price Stock Qty
HSV-2 gB 100µg
$330.00
In stock
HSV-2 gB 500µg
$1,320.00
In stock
HSV-2 gB 1mg
$2,640.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP6139
Physical appearance Sterile Filtered clear solution.
Formulation 10mM Phosphate buffer pH 7.6 and 75mM NaCl.
Amino acid sequence MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH.
Purity Protein is >90% pure as determined by SDS PAGE.
Stability HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C.  Please prevent freeze thaw cycles.
Source Escherichia Coli.
Transportation method Shipped with Ice Packs