HSV-2 gB

Name: HSV-2 gB
SKU: AP6139
Price: 330 USD
Rating: 5 (288 reviews)

Catalog No.: AP6139

The E.Coli derived HSV-2 gB recombinant protein is fused to a Six histidine tag at C-terminus and has a MW of 82kDa (pI 8.35).

Grouped product items
Size	Price	Stock
100µg	$330.00	In stock
500µg	$1,320.00	In stock
1mg	$2,640.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP6139
Physical appearance	Sterile Filtered clear solution.
Formulation	10mM Phosphate buffer pH 7.6 and 75mM NaCl.
Amino acid sequence	MIAPYKFKATMYYKDVTVSQVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRST AKYVRNNLETTAFHRDDHETDMELKPANAATRTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEHTSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTHHHHHH.
Purity	Protein is >90% pure as determined by SDS PAGE.
Stability	HSV-2 gB although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Source	Escherichia Coli.
Transportation method	Shipped with Ice Packs