IGF1 Gilthead Seabream

Catalog No.: AP3539
Insulin-Like Growth Factor 1 Gilthead Seabream Recombinant
Insulin-Like Growth Factor-IGilthead SeabreamRecombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 68 amino acids and having a molecular mass of 7545.4 Dalton, the predicted pI=7.72.IGF-1 is purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
IGF1 Gilthead Seabream 10µg
$110.00
In stock
IGF1 Gilthead Seabream 50µg
$290.00
In stock
IGF1 Gilthead Seabream 1mg
$4,620.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP3539
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The protein was lyophilized from a concentrated (1mg/ml) solution with 0.02% NaHCO3.
Amino acid sequence MSPETLCGAELVDTLQFVCGERGFYFSKPGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSK
Purity Greater than 98.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.
Stability Lyophilized Insulin-Like Growth Factor-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Source Escherichia Coli.
Synonyms Somatomedin C, IGF-I, IGFI.
Transportation method Shipped at Room temp