IGF1 Gilthead Seabream

Name: IGF1 Gilthead Seabream
Brand: Adooq Bioscience
SKU: AP3539
Rating: 5 (288 reviews)

Catalog No.: AP3539

Insulin-Like Growth Factor-IGilthead SeabreamRecombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 68 amino acids and having a molecular mass of 7545.4 Dalton, the predicted pI=7.72.IGF-1 is purified by proprietary chromatographic techniques.

Grouped product items
Size	Price	Stock
10µg	$110.00	In stock
50µg	$290.00	In stock
1000µg	$4,620.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP3539
Physical appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	The protein was lyophilized from a concentrated (1mg/ml) solution with 0.02% NaHCO3.
Amino acid sequence	MSPETLCGAELVDTLQFVCGERGFYFSKPGYGPNARRSRGIVDECCFQSCELRRLEMYCAPAKTSK
Purity	Greater than 98.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.
Stability	Lyophilized Insulin-Like Growth Factor-1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IGF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Source	Escherichia Coli.
Synonyms	Somatomedin C, IGF-I, IGFI.
Transportation method	Shipped at Room temp