Signaling Pathway
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
Not your Region? View all Distributors
| Catalog Num | AP5275 |
|---|---|
| Physical appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | The IL-1 beta was lyophilized from 1mg/ml in 1xPBS. |
| Amino acid sequence | APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS. |
| Uniprot ACC# | P01584 |
| Purity | Greater than 95% as obsereved by SDS-PAGE. |
| Stability | Lyophilized IL-1 beta although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL-1 beta should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Source | HEK. |
| Synonyms | Catabolin, Lymphocyte-activating factor (LAF), Endogenous Pyrogen (EP), Leukocyte Endogenous Mediator (LEM), Mononuclear Cell Factor (MCF), IL1F2, IL-1 beta. |
| Transportation method | Shipped at Room temp |
