Signaling Pathway
Important Notice: For research use only. We do not sell to patients.
Loading distributor info...
| Catalog Num | AP5346 |
|---|---|
| Physical appearance | Sterile filtered colorless solution. |
| Formulation | IL-6 is a sterile filtered (0.22µm) solution (0.22mg/ml) in 20mM Tris-HCl buffer pH 7.2. |
| Amino acid sequence | VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Uniprot ACC# | P05231 |
| Purity | Greater than 95.0% as determined by analysis by SDS-PAGE. |
| Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Source | Chinese Hamster Ovarian Cells. |
| Synonyms | IFN-b2, B cell differentiation factor, BCDF, BSF-2, HPGF, HSF, MGI-2, B-cell stimulatory factor 2, Interferon beta-2, Hybridoma growth factor, CTL differentiation factor, CDF, IL-6, HGF. |
| Transportation method | Shipped with Ice Packs |
