Signaling Pathway
Important Notice: For research use only. We do not sell to patients.
Loading distributor info...
| Catalog Num | AP5677 |
|---|---|
| Physical appearance | Sterile Filtered colorless solution. |
| Formulation | The IL-8 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5. |
| Amino acid sequence | AVLTRIGTELRCQCIKTHSTPFHPKFIKELRVIESGPHCANSEIIVKLVDGRELCLDPKEKWVQKVV QIFLKRAEQQES. |
| Uniprot ACC# | P19874 |
| Purity | Greater than 90% as determined by SDS-PAGE. |
| Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Source | Escherichia Coli. |
| Synonyms | IL-8, CXCL8, Monocyte-derived neutrophil chemotactic factor, MDNCF, T-cell chemotactic factor, Neutrophil-activating protein 1, NAP-1, Protein 3-10C, Granulocyte chemotactic protein 1, GCP-1, Monocyte-derived neutrophil-activating peptide, MONAP, Emoctakin, K60, NAF, LECT, LUCT, 3-10C, LYNAP, SCYB8, TSG-1, AMCF-I, b-ENAP. |
| Transportation method | Shipped with Ice Packs |
