Signaling Pathway
Important Notice: For research use only. We do not sell to patients.
Loading distributor info...
| Catalog Num | AP5420 |
|---|---|
| Physical appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | IL17E was lyophilized from a concentrated (1mg/ml) solution containing no additives. |
| Amino acid sequence | VSLRIQEGCSHLPSCCPSKEQEPPEEWLKWSSASVSPPEPLSHTHHAESCRASKDGPLNSRAISPWSYELDRDLNRVPQDLYHARCLCPHCVSLQTGSHMDPLGNSVPLYHNQTVFYRRPCHGEEGTHRRYCLERRLYRVSLACVCVRPRVMA. |
| Uniprot ACC# | Q8VHH8 |
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Stability | Lyophilized Murine IL17E although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution IL17E should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Source | Escherichia Coli. |
| Synonyms | IL-25, IL-17E, IL17E, IL25, Interleukin-25. |
| Transportation method | Shipped at Room temp |
