Insulin(cattle)

Catalog No.: A21565
Insulin cattle (Insulin from bovine pancreas) is a two-chain polypeptide hormone produced in vivo in the pancreatic β cells. Insulin cattle has often been used as growth supplement in culturing cells.
Grouped product items
Product Name Price Stock Qty
Insulin(cattle) 5mg
$30.00
In stock
Insulin(cattle) 10mg
$53.00
In stock
Insulin(cattle) 25mg
$81.00
In stock
Insulin(cattle) 50mg
$148.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Insulin cattle (Insulin from bovine pancreas) is a two-chain polypeptide hormone produced in vivo in the pancreatic β cells. Insulin cattle has often been used as growth supplement in culturing cells.
Product Information
Catalog Num A21565
Formula C254H377N65O75S6
Molecular Weight 5800 (Approximately)
CAS Number 11070-73-8
Sequence Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala. Gly-Ile-Val-Glu-Gln-Cys-Cys-Ala-Ser-Val-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'
Sequence shortening FVNQHLCGSHLVEALYLVCGERGFFYTPKA. GIVEQCCASVCSLYQLENYCN (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'-Cys11')
Synonyms Insulin from bovine pancreas
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Insulin(cattle) | Insulin(cattle) Supplier | purchase Insulin(cattle) | Insulin(cattle) cost | Insulin(cattle) manufacturer | order Insulin(cattle) | Insulin(cattle) distributor | buy 11070-73-8 | 11070-73-8 Supplier | purchase 11070-73-8 | 11070-73-8 cost | 11070-73-8 manufacturer | order 11070-73-8 | 11070-73-8 distributor