• Sign In
  • FAQ
  • Create an Account
Currency
USD
Toggle Nav
My Cart
Search
Menu
Account
Settings
Currency
USD

Leptin Pufferfish

Catalog No.: AP3568
Leptin Pufferfish Recombinant
Leptin Pufferfish (Takifugu rubripes) Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain having a molecular mass of 16 kDa. Bioactive Leptin Pufferfish (Takifugu rubripes) Recombinant was prepared according to the sequence published by Kurokawa et al. (2005)Peptides 26, 745-750 in two forms: monomer and covalent dimer. MS analysis revealed molecular masses of 15,291 and 30,585 Da, close to the theoretical values of 15,270 and 30,540 Da. CD spectra revealed high similarity to mammalian leptins. Other details of its preparation will be soon published by Yacobovitz et al (in press), General and Comparative Endocrinology.The Pufferfish Leptin is purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
Leptin Pufferfish 20µg
$110.00
In stock
Leptin Pufferfish 100µg
$290.00
In stock
Leptin Pufferfish 1mg
$2,310.00
In stock
Bulk Inquiry
Notify me when the price drops

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

HeadquaterContact US

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP3568
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The Pufferfish Leptin was lyophilized from a concentrated (0.85mg/ml) solution with 0.003mM NaHCO3.
Amino acid sequence ALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVE GSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQE QQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC
Uniprot ACC# Q588G0
Purity Greater than 99.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.
Stability Lyophilized Pufferfish Leptin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leptin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Source Escherichia Coli.
Synonyms OB Protein, Obesity Protein, OBS, Obesity factor.
Transportation method Shipped at Room temp
Growth Factors