Leptin Pufferfish

Catalog No.: AP3568
Leptin Pufferfish (Takifugu rubripes) Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain having a molecular mass of 16 kDa. Bioactive Leptin Pufferfish (Takifugu rubripes) Recombinant was prepared according to the sequence published by Kurokawa et al. (2005)Peptides 26, 745-750 in two forms: monomer and covalent dimer. MS analysis revealed molecular masses of 15,291 and 30,585 Da, close to the theoretical values of 15,270 and 30,540 Da. CD spectra revealed high similarity to mammalian leptins. Other details of its preparation will be soon published by Yacobovitz et al (in press), General and Comparative Endocrinology.The Pufferfish Leptin is purified by proprietary chromatographic techniques.
Grouped product items
Size Price Stock Qty
20µg
$110.00
In stock
100µg
$290.00
In stock
1000µg
$2,310.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500
Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Science VOLUME 380, ISSUE 6663 (2023)
Science VOLUME 369, ISSUE 6510 (2020)
Science VOLUME 356, ISSUE 6336 (2017)
Cell Vol. 185 Issue 23 p4428-4447.e28
Cell Vol 177, Issue 7, p1933-1947.e25
Cell Vol 156, Issue 5, p857-1114
Nature Volume 622 Issue 7982 (2023)
Nature volume 620, pages890-897 (2023)
Nature volume 610, pages540-546 (2022)
Nature volume 588, pages83-88 (2020)
Nature volume 574, pages268-272 (2019)
Nature volume 573, pages539-545 (2019)
Nature volume 567, pages118-122 (2019)
Nature volume 551, pages639-643 (2017)
Nature volume 551, pages247-250 (2017)
Nature volume 548, pages356-360 (2017)
Nature volume 545, pages187-192 (2017)
Protein Information
Catalog NumAP3568
Physical appearanceSterile Filtered White lyophilized (freeze-dried) powder.
FormulationThe Pufferfish Leptin was lyophilized from a concentrated (0.85mg/ml) solution with 0.003mM NaHCO3.
Amino acid sequenceALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVE GSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQE QQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC
Uniprot ACC#Q588G0
PurityGreater than 99.0% as determined by:(a) Analysis by SEC-HPLC.(b) Analysis by SDS-PAGE.
StabilityLyophilized Pufferfish Leptin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leptin should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
SourceEscherichia Coli.
SynonymsOB Protein, Obesity Protein, OBS, Obesity factor.
Transportation methodShipped at Room temp