LL-37, human

Catalog No.: A22714
LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing.
Grouped product items
Product Name Price Stock Qty
LL-37, human 1mg
$116.00
In stock
LL-37, human 5mg
$217.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription LL-37, human is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, human could help protect the cornea from infection and modulates wound healing.
Product Information
Catalog Num A22714
Formula C205H340N60O53
Molecular Weight 4493.26
CAS Number 154947-66-7
Sequence Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
Sequence shortening [LL-37, 37 aa]
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy LL-37, human | LL-37, human Supplier | purchase LL-37, human | LL-37, human cost | LL-37, human manufacturer | order LL-37, human | LL-37, human distributor | buy 154947-66-7 | 154947-66-7 Supplier | purchase 154947-66-7 | 154947-66-7 cost | 154947-66-7 manufacturer | order 154947-66-7 | 154947-66-7 distributor