MIP 5 Human

Catalog No.: AP5723
Macrophage Inflammatory Protein-5 Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 92 amino acids and having a molecular mass of 10.1 kDa. The MIP5 is purified by proprietary chromatographic techniques.
Grouped product items
Size Price Stock Qty
5µg
$110.00
In stock
25µg
$290.00
In stock
1mg
$5,940.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP5723
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation MIP5 was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 100mM NaCl.
Amino acid sequence QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI.
Uniprot ACC# Q16663
Purity Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Stability Lyophilized MIP-5 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CCL15 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Source Escherichia Coli.
Synonyms Small inducible cytokine A15 precursor, CCL15, Macrophage inflammatory protein 5, MIP-5, MIP5, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 delta, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15.
Transportation method Shipped at Room temp