NEP(1-40)

Catalog No.: A22826
NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition.
Grouped product items
Product Name Price Stock Qty
NEP(1-40) 1mg
$356.00
In stock
NEP(1-40) 5mg
$1,098.00
In stock
NEP(1-40) 10mg
$1,702.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription NEP(1-40) is a Nogo-66 receptor (NgR) antagonist peptide, reversing the injury-induced shift in distribution of microglia morphologies by limiting myelin-based inhibition.
Product Information
Catalog Num A22826
Formula C206H324N56O65
Molecular Weight 4625.11
CAS Number 475221-20-6
Sequence Arg-Ile-Tyr-Lys-Gly-Val-Ile-Gln-Ala-Ile-Gln-Lys-Ser-Asp-Glu-Gly-His-Pro-Phe-Arg-Ala-Tyr-Leu-Glu-Ser-Glu-Val-Ala-Ile-Ser-Glu-Glu-Leu-Val-Gln-Lys-Tyr-Ser-Asn-Ser-NH2
Sequence shortening RIYKGVIQAIQKSDEGHPFRAYLESEVAISEELVQKYSNS-NH2
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy NEP(1-40) | NEP(1-40) Supplier | purchase NEP(1-40) | NEP(1-40) cost | NEP(1-40) manufacturer | order NEP(1-40) | NEP(1-40) distributor | buy 475221-20-6 | 475221-20-6 Supplier | purchase 475221-20-6 | 475221-20-6 cost | 475221-20-6 manufacturer | order 475221-20-6 | 475221-20-6 distributor