Omp Pylori

Catalog No.: AP6019
Helicobacter Pylori Outer Membrane Protein Recombinant
Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.
Grouped product items
Product Name Price Stock Qty
Omp Pylori 100µg
$330.00
In stock
Omp Pylori 500µg
$1,320.00
In stock
Omp Pylori 1mg
$2,640.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP6019
Physical appearance Sterile filtered liquid formulation.
Formulation The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.
Amino acid sequence MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.
Purity Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Stability Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Source E.Coli
Transportation method Shipped with Ice Packs