Omp Pylori

Name: Omp Pylori
SKU: AP6019
Price: 330 USD
Rating: 5 (288 reviews)

Catalog No.: AP6019

Omp Pylori recombinant antigen is produced in E. coli expressing the H. pylori outer membrane protein having the Mw of 23 kDa. Omp Pylori recombinant antigen is well recognized by specific IgG and IgM from H. pylori infected patients.

Grouped product items
Size	Price	Stock
100µg	$330.00	In stock
500µg	$1,320.00	In stock
1mg	$2,640.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP6019
Physical appearance	Sterile filtered liquid formulation.
Formulation	The Omp Pylori recombinant protein is formulated in 1xPBS pH 7.4.
Amino acid sequence	MLVTKLAPDFKAPAVLGNNEVDEHFELSKNLGKNGAILFFWPKDFTFVCPTEIIAFDKRVKDFQEKGFNVIGVSIDSEQVHFAWKNTPVEKGGIGQVTFPMVADITKSISRDYDVLFEEAIALRGAFLIDKNMKVRHAVINDLPLGRNADEMLRMVDALLHFEEHGEVCPAGWRKGDKGMKATHQGVAEYLKENSIKL.
Purity	Greater than 95% pure as determined by 12% PAGE (Coomassie staining).
Stability	Omp Pylori although stable at 4°C for 1 week, should be stored below -18°C. Please prevent freeze thaw cycles.
Source	E.Coli
Transportation method	Shipped with Ice Packs