Signaling Pathway
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
Not your Region? View all Distributors
| Catalog Num | AP3846 |
|---|---|
| Physical appearance | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Formulation | CDKN2A was lyophilized from a concentrated (1mg/ml) sterile solution containing 1x PBS pH-7.4. |
| Amino acid sequence | MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD. |
| Uniprot ACC# | P42771 |
| Purity | Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Stability | Lyophilized Cyclin-dependent kinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Cyclin-dependent kinase should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles. |
| Source | Escherichia Coli. |
| Synonyms | Cyclin-dependent kinase 4 inhibitor A, CDK4I, p16-INK4, p16-INK4a, p16INK4A, CDKN-2A, CDKN2, Multiple tumor suppressor 1, MTS1, CMM2, MLM, TP16, p16(INK4), p19. |
| Transportation method | Shipped at Room temp |
