PACAP (1-38), human, ovine, rat

Catalog No.: A22720
PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
Grouped product items
Product Name Price Stock Qty
PACAP (1-38), human, ovine, rat 0.5mg
$125.00
In stock
PACAP (1-38), human, ovine, rat 1mg
$167.00
In stock
PACAP (1-38), human, ovine, rat 5mg
$481.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
Product Information
Catalog Num A22720
Formula C203H331N63O53S
Molecular Weight 4534.26
CAS Number 137061-48-4
Sequence His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Sequence shortening HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Synonyms Pituitary Adenylate Cyclase Activating Polypeptide 38
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy PACAP (1-38), human, ovine, rat | PACAP (1-38), human, ovine, rat Supplier | purchase PACAP (1-38), human, ovine, rat | PACAP (1-38), human, ovine, rat cost | PACAP (1-38), human, ovine, rat manufacturer | order PACAP (1-38), human, ovine, rat | PACAP (1-38), human, ovine, rat distributor | buy 137061-48-4 | 137061-48-4 Supplier | purchase 137061-48-4 | 137061-48-4 cost | 137061-48-4 manufacturer | order 137061-48-4 | 137061-48-4 distributor