PACAP (1-38), human, ovine, rat

Name: PACAP (1-38), human, ovine, rat
Brand: Adooq Bioscience
SKU: A22720
Rating: 5 (288 reviews)

Catalog No.: A22720

PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

Skip to the end of the images gallery

PACAP (1-38), human, ovine, rat 137061-48-4

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
500µg	$90.00	In stock
1mg	$135.00	In stock
5mg	$340.00	In stock
10mg	$510.00	In stock
25mg	$840.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.

Product Information

Catalog Num	A22720
Formula	C203H331N63O53S
Molecular Weight	4534.26
CAS Number	137061-48-4
Sequence	His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Sequence shortening	HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Synonyms	Pituitary Adenylate Cyclase Activating Polypeptide 38
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂