PLA2G2D Human

Catalog No.: AP4738
Secreted Phospholipase A2-IID Human Recombinant
Secreted Phospholipase A2-IID Human Recombinant was produced with N-terminal His-Tag. PLA2G2D His-Tagged Fusion protein is 16.4 kDa containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues ?C His-Tag (underlined).
Grouped product items
Product Name Price Stock Qty
PLA2G2D Human 2µg
$110.00
In stock
PLA2G2D Human 10µg
$290.00
In stock
PLA2G2D Human 1mg
$8,580.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP4738
Physical appearance Sterile Filtered lyophilized (freeze-dried) powder.
Formulation Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.
Amino acid sequence MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGR GQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWC EQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC.
Uniprot ACC# Q9UNK4
Stability Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Source Escherichia Coli.
Synonyms Group IID secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIID, GIID sPLA2, PLA2IID, sPLA(2)-IID, Secretory-type PLA, stroma-associated homolog, SPLASH, sPLA2S, PLA2G2D.
Transportation method Shipped at Room temp