PLA2G2E Human

Name: PLA2G2E Human
Brand: Adooq Bioscience
SKU: AP4739
Rating: 5 (288 reviews)

Catalog No.: AP4739

Secreted Phospholipase A2-IIE Human Recombinant manufactured with N-terminal His-Tag. PLA2G2E His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues ?C His-Tag (underlined).MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC.

Grouped product items
Size	Price	Stock
2µg	$110.00	In stock
10µg	$290.00	In stock
1000µg	$8,580.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP4739
Physical appearance	Sterile Filtered lyophilized (freeze-dried) powder.
Formulation	Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.
Uniprot ACC#	Q9NZK7
Purity	Greater than 95% as determined by SDS PAGE.
Stability	Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Source	Escherichia Coli.
Synonyms	Group IIE secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIIE, GIIE sPLA2, sPLA(2)-IIE, sPLA2-IIE, PLA2G2E.
Transportation method	Shipped at Room temp