• Sign In
  • FAQ
  • Create an Account
Currency
USD
Toggle Nav
My Cart
Search
Menu
Account
Settings
Currency
USD

PLA2G2E Human

Catalog No.: AP4739
Secreted Phospholipase A2-IIE Human Recombinant
Secreted Phospholipase A2-IIE Human Recombinant manufactured with N-terminal His-Tag. PLA2G2E His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues ?C His-Tag (underlined).MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC.
Grouped product items
Product Name Price Stock Qty
PLA2G2E Human 2µg
$110.00
In stock
PLA2G2E Human 10µg
$290.00
In stock
PLA2G2E Human 1mg
$8,580.00
In stock
Bulk Inquiry
Notify me when the price drops

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

HeadquaterContact US

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP4739
Physical appearance Sterile Filtered lyophilized (freeze-dried) powder.
Formulation Sterile filtered and lyophilized from 0.5 mg/ml in 0.05M Acetate buffer pH-4.
Uniprot ACC# Q9NZK7
Purity Greater than 95% as determined by SDS PAGE.
Stability Store lyophilized protein at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles. Reconstituted protein can be stored at 4°C for a limited period of time; it does not show any change after two weeks at 4°C.
Source Escherichia Coli.
Synonyms Group IIE secretory phospholipase A2, EC 3.1.1.4, Phosphatidylcholine 2-acylhydrolase GIIE, GIIE sPLA2, sPLA(2)-IIE, sPLA2-IIE, PLA2G2E.
Transportation method Shipped at Room temp
Enzymes