Pramlintide acetate

Catalog No.: A22770
Pramlintide acetate is a polypeptide analogue of human amylin. Pramlintide acetate, an antidiabetic agent, is antineoplastic in colorectal cancer.
Grouped product items
Product Name Price Stock Qty
Pramlintide acetate 5mg
$152.00
In stock
Pramlintide acetate 10mg
$228.00
In stock
Pramlintide acetate 25mg
$522.00
In stock
Pramlintide acetate 50mg
$814.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Pramlintide acetate is a polypeptide analogue of human amylin. Pramlintide acetate, an antidiabetic agent, is antineoplastic in colorectal cancer.
Product Information
Catalog Num A22770
Formula C173H271N51O55S2
Molecular Weight 4009.44
CAS Number 187887-46-3
Sequence Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 (Disulfide bridge:Cys2-Cys7)
Sequence shortening KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Disulfide bridge:Cys2-Cys7)
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Pramlintide acetate | Pramlintide acetate Supplier | purchase Pramlintide acetate | Pramlintide acetate cost | Pramlintide acetate manufacturer | order Pramlintide acetate | Pramlintide acetate distributor | buy 187887-46-3 | 187887-46-3 Supplier | purchase 187887-46-3 | 187887-46-3 cost | 187887-46-3 manufacturer | order 187887-46-3 | 187887-46-3 distributor