PRL R Human

Name: PRL R Human
SKU: AP3666
Price: 110 USD
Rating: 5 (288 reviews)

Catalog No.: AP3666

Prolactin Soluble Receptor Human Recombinant

Extra Cellular Domain Prolactin Receptor Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containsing 210 amino acids and having a molecular mass of 23.97 kDa. The Prolactin Receptor is purified by proprietary chromatographic techniques according to Bignon et al. (1994) JBC 269; 3318-24 and tested according to Gertler et al. (1996) JBC 271; 24482-91.

Notify me when the price drops

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Contact your local distributors

Not your Region? View all Distributors

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP3666
Physical appearance	Sterile filtered white lyophilized powder.
Formulation	The Prolactin Receptor was lyophilized from a concentrated (0.4mg/ml) solution with 0.0045mM NaHCO3.
Amino acid sequence	AGKPEIFKCRSPNKETFTCWWRPGTDGGLPTNYSLTYHREGETLMHECPDYITGGPNSCHFGKQYTSMWRTYIMMVNATNQMGSSFSDELYVDVTYIVQPDPPLELAVEVKQPEDRKPYLWIKWSPPTLIDLKTGWFTLLYEIRLKPEKAAEWEIHFAGQQTEFKILSLHPGQKYLVQVRCKPDHGYWSAWSPATFIQIPSDFTMNDTTVW.
Uniprot ACC#	P16471
Purity	Greater than 97.0% as determined by:(a) Analysis by SEC-HPLC. (b) Analysis by SDS-PAGE.(c) Gel filtration at pH 8 under non denaturative conditions.
Stability	Lyophilized PRL-R although stable at room temperature for 1-2 weeks, should be stored desiccated below -18°C or preferably even at -80°C to prevent dimer formation. Upon reconstitution PRL-R should be stored sterile at 4°C between 2-7 days and for future use below -18°C. For long term storage at 4°C it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles as they cause oligomerization of the protein.
Source	Escherichia Coli.
Synonyms	PRL-R, hPRLrI.
Transportation method	Shipped at Room temp

Product Name	Price	Stock
PRL R Human 5µg	$110.00	In stock
PRL R Human 20µg	$290.00	In stock
PRL R Human 1mg	$7,400.00	In stock

Bioquote Limited.	The Raylor Centre,James Street, York YO10 3DW, United Kingdom Tel: 00 44 1904 431402 Fax: 00 44 1904 431409 www.bioquote.com [email protected]
Generon UK.	11 Whittle Parkway, Progress Business Park, Slough SL1 6DQ, United Kingdom Tel: +44 (0)1753 866 511 Fax: +44 (0)1753 208 899 www.generon.co.uk [email protected]