Streptavidin Recombinant

Catalog No.: AP2203
Streptavidin Recombinant
Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa.
Grouped product items
Product Name Price Stock Qty
Streptavidin Recombinant 5mg
$110.00
In stock
Streptavidin Recombinant 20mg
$290.00
In stock
Streptavidin Recombinant 1gr
$7,700.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP2203
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation Lyophilized in 10mM potassium phosphate buffer pH 6.5.
Amino acid sequence MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.
Uniprot ACC# P22629
Purity Greater than 98.0% as determined by SDS-PAGE and HPLC.
Stability Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.
Source Escherichia Coli.
Transportation method Shipped at Room temp