Streptavidin Recombinant

Name: Streptavidin Recombinant
Brand: Adooq Bioscience
SKU: AP2203
Rating: 5 (288 reviews)

Catalog No.: AP2203

Streptavidin Streptomyces Avidinii Recombinant produced in E.Coli. The molecular weight per tetramer is approximately 52kDa.

Grouped product items
Size	Price	Stock
5mg	$110.00	In stock
20mg	$290.00	In stock
1000µg	$7,700.00	In stock
Bulk Size	Bulk Discount

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP2203
Physical appearance	Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation	Lyophilized in 10mM potassium phosphate buffer pH 6.5.
Amino acid sequence	MAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTTEANAWKSTLVGHDTFTKVKPSAAS.
Uniprot ACC#	P22629
Purity	Greater than 98.0% as determined by SDS-PAGE and HPLC.
Stability	Streptavidin is shipped at ambient temperature, upon arrival store at -20°C.
Source	Escherichia Coli.
Transportation method	Shipped at Room temp