Tat-beclin 1

Catalog No.: A22737
Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV).
Grouped product items
Product Name Price Stock Qty
Tat-beclin 1 1mg
$112.00
In stock
Tat-beclin 1 5mg
$248.00
In stock
Tat-beclin 1 10mg
$404.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Tat-beclin 1, a peptide derived from a region of the autophagy protein (beclin 1), is a potent inducer of autophagy and interacts with negative regulator of autophagy, GAPR-1 (GLIPR2). Tat-beclin 1 decreases the accumulation of polyglutamine expansion protein aggregates and the replication of several pathogens (including HIV-1) in vitro, and reduces mortality in mice infected with chikungunya (CHIKV) or West Nile virus (WNV).
Product Information
Catalog Num A22737
Formula C164H251N57O45
Molecular Weight 3741.1
CAS Number 1423821-88-8
Sequence Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr
Sequence shortening YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Tat-beclin 1 | Tat-beclin 1 Supplier | purchase Tat-beclin 1 | Tat-beclin 1 cost | Tat-beclin 1 manufacturer | order Tat-beclin 1 | Tat-beclin 1 distributor | buy 1423821-88-8 | 1423821-88-8 Supplier | purchase 1423821-88-8 | 1423821-88-8 cost | 1423821-88-8 manufacturer | order 1423821-88-8 | 1423821-88-8 distributor