TAT-HA2 Fusion Peptide

Catalog No.: A22543
TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety.
Grouped product items
Product Name Price Stock Qty
TAT-HA2 Fusion Peptide 5mg
$248.00
In stock
TAT-HA2 Fusion Peptide 10mg
$364.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription TAT-HA2 Fusion Peptide is a peptide-based delivery agent that combines the pH-sensitive HA2 fusion peptide from Influenza and the cell-penetrating peptide TAT from HIV. TAT-HA2 Fusion Peptide induces the cellular uptake of macromolecules into endosomes via the TAT moiety and to respond to the acidifying lumen of endosomes to cause membrane leakage and release of macromolecules into cells via the HA2 moiety.
Product Information
Catalog Num A22543
Formula C149H243N53O39S
Molecular Weight 3432.92
CAS Number 923954-79-4
Sequence Arg-Arg-Arg-Gln-Arg-Arg-Lys-Lys-Arg-Gly-Gly-Asp-Ile-Met-Gly-Glu-Trp-Gly-Asn-Glu-Ile-Phe-Gly-Ala-Ile-Ala-Gly-Phe-Leu-Gly
Sequence shortening RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy TAT-HA2 Fusion Peptide | TAT-HA2 Fusion Peptide Supplier | purchase TAT-HA2 Fusion Peptide | TAT-HA2 Fusion Peptide cost | TAT-HA2 Fusion Peptide manufacturer | order TAT-HA2 Fusion Peptide | TAT-HA2 Fusion Peptide distributor | buy 923954-79-4 | 923954-79-4 Supplier | purchase 923954-79-4 | 923954-79-4 cost | 923954-79-4 manufacturer | order 923954-79-4 | 923954-79-4 distributor