Teduglutide

Catalog No.: A22768
Teduglutide is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide is associated with trophic effects on gut mucosa. Teduglutide can be used for the research of short bowel syndrome (SBS) and Crohn's disease (CD).
Grouped product items
Product Name Price Stock Qty
Teduglutide 1mg
$104.00
In stock
Teduglutide 5mg
$180.00
In stock
Teduglutide 10mg
$316.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Teduglutide is a dipeptidyl peptidase IV resistant glucagon-like peptide 2 (GLP-2) analogue. Teduglutide is associated with trophic effects on gut mucosa. Teduglutide can be used for the research of short bowel syndrome (SBS) and Crohn's disease (CD).
Product Information
Catalog Num A22768
Formula C164H252N44O55S
Molecular Weight 3752.13
CAS Number 197922-42-2
Sequence shortening HGDGSFSDEMNTILDNLAARDFINWLIQTKITD
Synonyms ALX-0600
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Teduglutide | Teduglutide Supplier | purchase Teduglutide | Teduglutide cost | Teduglutide manufacturer | order Teduglutide | Teduglutide distributor | buy 197922-42-2 | 197922-42-2 Supplier | purchase 197922-42-2 | 197922-42-2 cost | 197922-42-2 manufacturer | order 197922-42-2 | 197922-42-2 distributor