• Sign In
  • FAQ
  • Create an Account
Currency
USD
Toggle Nav
My Cart
Search
Menu
Account
Settings
Currency
USD

TFF1 Human

Catalog No.: AP5538
Trefoil Factor-1 Human Recombinant
TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa. TFF-1 Human Recombinant is purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
TFF1 Human 5µg
$110.00
In stock
TFF1 Human 20µg
$290.00
In stock
TFF1 Human 1mg
$5,940.00
In stock
Bulk Inquiry
Notify me when the price drops

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

HeadquaterContact US

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP5538
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation The Human TFF1 protein was lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl.
Amino acid sequence EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF.
Uniprot ACC# P04155
Purity Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Stability Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Source Escherichia Coli.
Synonyms TFF-1, TFF1, pS2, BCEI, HPS, HP1.A, pNR-2, D21S21, pS2 protein, Trefoil factor 1, Breast cancer estrogen-inducible protein.
Transportation method Shipped at Room temp
Cytokines