Signaling Pathway
For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.
Not your Region? View all Distributors
| Catalog Num | AP3695 |
|---|---|
| Physical appearance | Sterile Filtered solution. |
| Formulation | The protein solution (500µg/ml) contains 50mM Tris-HCl, pH-7.5 and 10mM L-glutathione (reduced). |
| Amino acid sequence | KWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS. |
| Uniprot ACC# | P01137 |
| Purity | Greater than 80.0% as determined by SDS-PAGE. |
| Stability | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Avoid multiple freeze-thaw cycles. |
| Source | Escherichia Coli. |
| Synonyms | Transforming growth factor beta-1, TGF-beta-1, CED, DPD1, TGFB. |
| Transportation method | Shipped with Ice Packs |
