TGFB2 Human

Catalog No.: AP3694
Transforming Growth Factor Beta 2 Human Recombinant
TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
TGFB2 Human 1µg
$110.00
In stock
TGFB2 Human 5µg
$290.00
In stock
TGFB2 Human 100µg
$3,300.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP3694
Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.
Amino acid sequence HHHHHHALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTI LYYIGKTPKIEQLSNMIVKSCKCS.
Uniprot ACC# P61812
Purity Greater than 97.0% as determined by SDS-PAGE.
Stability Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Source Nicotiana benthamiana.
Synonyms Transforming growth factor, beta 2, cetermin, Glioblastoma-derived T-cell suppressor factor, polyergin, G-TSF, TGF-beta2, TGF-beta-2, transforming growth factor beta-2, BSC-1 cell growth inhibitor, TGFB-2.
Transportation method Shipped at Room temp