TNFR Human, His

Catalog No.: AP5571
Tumor Necrosis Factor Receptor Type Human Recombinant, His Tag
TNFR Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 161 amino acids fragment (41-201) having a molecular weight of 22.68kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR His Tag is purified by proprietary chromatographic techniques.
Grouped product items
Product Name Price Stock Qty
TNFR Human, His 5µg
$110.00
In stock
TNFR Human, His 20µg
$290.00
In stock
TNFR Human, His 1mg
$10,560.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP5571
Physical appearance Sterile Filtered clear solution.
Formulation TNFR His Tag protein is supplied in 1xPBS, 50% glycerol.
Amino acid sequence DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN.
Uniprot ACC# P19438
Purity Greater than 95.0% as determined by SDS-PAGE.
Stability Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Source Escherichia Coli.
Synonyms Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588.
Transportation method Shipped with Ice Packs