TNFR Human, His

Name: TNFR Human, His
SKU: AP5571
Price: 110 USD
Rating: 5 (288 reviews)

Catalog No.: AP5571

TNFR Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 161 amino acids fragment (41-201) having a molecular weight of 22.68kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR His Tag is purified by proprietary chromatographic techniques.

Grouped product items
Size	Price	Stock
5µg	$110.00	In stock
20µg	$290.00	In stock
1mg	$10,560.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP5571
Physical appearance	Sterile Filtered clear solution.
Formulation	TNFR His Tag protein is supplied in 1xPBS, 50% glycerol.
Amino acid sequence	DSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN.
Uniprot ACC#	P19438
Purity	Greater than 95.0% as determined by SDS-PAGE.
Stability	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Source	Escherichia Coli.
Synonyms	Tumor necrosis factor receptor superfamily member 1A, Tumor necrosis factor receptor 1, Tumor necrosis factor receptor type I, TNF-R1, TNF-RI, TNFR-I, p60, p55, CD120a, TNFRSF1A, TNFAR, TNFR1, FPF, TBP1, TNF-R, p55-R, TNFR55, TNFR60, TNF-R-I, TNF-R55, MGC19588.
Transportation method	Shipped with Ice Packs