TNFR2 Human, His

Name: TNFR2 Human, His
SKU: AP5572
Price: 110 USD
Rating: 5 (288 reviews)

Catalog No.: AP5572

TNFR2 Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 184 amino acids fragment (23-206) having a molecular weight of 24.45kDa and fused with a 4.5kDa amino-terminal hexahistidine tag. The TNFR2 is purified by proprietary chromatographic techniques.

Grouped product items
Size	Price	Stock
5µg	$110.00	In stock
20µg	$290.00	In stock
1mg	$10,560.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP5572
Physical appearance	Sterile Filtered clear solution.
Formulation	TNFR2 protein is supplied in 20mM Tris HCl pH-8, 5mM EDTA and 50% glycerol.
Amino acid sequence	LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSDTVCDSCEDSTYTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQEGCRLCAPLRKCRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPGNASMDAVCTSTSPT.
Uniprot ACC#	P20333
Purity	Greater than 95.0% as determined by SDS-PAGE.
Stability	Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. Please avoid freeze thaw cycles.
Source	Escherichia Coli.
Synonyms	Tumor necrosis factor receptor superfamily member 1B, Tumor necrosis factor receptor 2, Tumor necrosis factor receptor type II, p75, p80 TNF-alpha receptor, CD120b, Etanercept, TNF-R2, TNF-RII, TNFR-II, TNFRSF1B, TNFBR, TNFR2, TBPII, TNFR2, TNFR1B, TNFR80, TNF-R75, p75TNFR, TNF-R-II.
Transportation method	Shipped with Ice Packs