Trypsin Porcine

Name: Trypsin Porcine
Brand: Adooq Bioscience
SKU: AP2199
Rating: 5 (288 reviews)

Catalog No.: AP2199

Recombinant Porcine Trypsin is free from any animal and human sources. Recombinant Porcine Trypsin expressed in Yeast and purified by standard chromatography techniques. Recombinant Porcine Trypsin is free from foreign enzymes such as carboxypeptidase A & chymotrypsin. Recombinant Human Trypsin is free from protease inhibitors such as PMSF and EDTA.

Grouped product items
Size	Price	Stock
1mg	$110.00	In stock
2.5mg	$290.00	In stock
50mg	$1,980.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Loading distributor info...

Adooq Products cited in reputable paper

Protein Information

Catalog Num	AP2199
Physical appearance	Sterile Filtered clear liquid solution.
Formulation	The Porcine Trypsin (2.98mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH-3.
Amino acid sequence	VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN.
Stability	Recombinant Porcine Trypsin should be stored at 2-8°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Source	Pichia Pastoris.
Transportation method	Shipped with Ice Packs