Trypsin Porcine

Catalog No.: AP2199
Trypsin Porcine Recombinant
Recombinant Porcine Trypsin is free from any animal and human sources. Recombinant Porcine Trypsin expressed in Yeast and purified by standard chromatography techniques. Recombinant Porcine Trypsin is free from foreign enzymes such as carboxypeptidase A & chymotrypsin. Recombinant Human Trypsin is free from protease inhibitors such as PMSF and EDTA.
Grouped product items
Product Name Price Stock Qty
Trypsin Porcine 1mg
$110.00
In stock
Trypsin Porcine 2.5mg
$290.00
In stock
Trypsin Porcine 50mg
$1,980.00
In stock

For laboratory research use only. Direct human use, including taking orally and injection and clinical use are forbidden.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Protein Information
Catalog Num AP2199
Physical appearance Sterile Filtered clear liquid solution.
Formulation The Porcine Trypsin (2.98mg/ml) is formulated with 1mM HCl and 20mM CaCl2, pH-3.
Amino acid sequence VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRIQVRLGEHNI DVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATVSLPRSCA AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGNMICVGF LEGGKDSCQGDSGGPVVCNGQLQGIVSWGYGCAQKNKPGVYTKVCNYVNWI QQTIAAN.
Stability Recombinant Porcine Trypsin should be stored at 2-8°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Source Pichia Pastoris.
Transportation method Shipped with Ice Packs