Urodilatin

Name: Urodilatin
Brand: Adooq Bioscience
SKU: A23884
Rating: 5 (288 reviews)

Catalog No.: A23884

Diuretic-natriuretic regulatory peptide

Urodilatin is an analogue of ANF-(99-126). Urodilatin is a diuretic-natriuretic regulatory peptide. Urodilatin can be used for research of acute renal failure, congestive heart failure, and bronchial asthma, etc.

Skip to the end of the images gallery

Urodilatin 115966-23-9 <p>Diuretic-natriuretic regulatory peptide</p>

Skip to the beginning of the images gallery

Grouped product items
Size	Price	Stock
500µg	$980.00	In stock
1mg	$1,880.00	In stock
Bulk Size	Bulk Discount

Bulk Inquiry

Notify me when the price drops

Free Delivery on orders over $500

Research use only. We do not sell to patients.

Data Sheet SDS

Loading distributor info...

Adooq Products cited in reputable paper

Biological Activity

Description	Urodilatin is an analogue of ANF-(99-126). Urodilatin is a diuretic-natriuretic regulatory peptide. Urodilatin can be used for research of acute renal failure, congestive heart failure, and bronchial asthma, etc.

Product Information

Catalog Num	A23884
Formula	C145H236N52O44S3
Molecular Weight	3507.94
CAS Number	115966-23-9
Sequence	Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr
Sequence shortening	TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Storage	Store lyophilized at -20ºC, keep desiccated. In lyophilized form, the chemical is stable for 36 months. In solution, store at -20ºC and use within 1 months to prevent loss of potency. Aliquot to avoid multiple freeze/thaw cycles.

Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

* Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C₁V₁ = C₂V₂