Urodilatin

Catalog No.: A23884

Diuretic-natriuretic regulatory peptide

Urodilatin is an analogue of ANF-(99-126). Urodilatin is a diuretic-natriuretic regulatory peptide. Urodilatin can be used for research of acute renal failure, congestive heart failure, and bronchial asthma, etc.
Grouped product items
Product Name Price Stock Qty
Urodilatin 0.5mg
$1,025.00
In stock
Bulk Size
Bulk Discount
Free Delivery on orders over $500

Important Notice: For research use only. We do not sell to patients.

Not your Region? View all Distributors

Adooq Products cited in reputable paper
Biological Activity
Discription Urodilatin is an analogue of ANF-(99-126). Urodilatin is a diuretic-natriuretic regulatory peptide. Urodilatin can be used for research of acute renal failure, congestive heart failure, and bronchial asthma, etc.
Product Information
Catalog Num A23884
Formula C145H236N52O44S3
Molecular Weight 3507.94
CAS Number 115966-23-9
Sequence Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr
Sequence shortening TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY
Useful Calculator

This calculator helps you calculate mass of compound based on solution concentration, volume and molecular weight in a specific solution using the formula:

Mass (mg) = Concentration (mM) × Volume (mL) × Molecular Weight (g/mol)

  • Mass

    Concentration

    Volume

    Molecular Weight

Please check COA/MSDS for correct molecular weight.

Calculate the dilution required to prepare a stock solution.
This equation is commonly abbreviated as: C1V1 = C2V2

  • C1

    V1

    C2

    V2

  • Calculator Reset
Keywords: buy Urodilatin | Urodilatin Supplier | purchase Urodilatin | Urodilatin cost | Urodilatin manufacturer | order Urodilatin | Urodilatin distributor | buy 115966-23-9 | 115966-23-9 Supplier | purchase 115966-23-9 | 115966-23-9 cost | 115966-23-9 manufacturer | order 115966-23-9 | 115966-23-9 distributor